The domain within your query sequence starts at position 365 and ends at position 514; the E-value for the SE domain shown below is 5.7e-64.

QLPGVLILGDAYNLRHPLTGGGMTVALKDIKLWRQLLKDIPDLYDDAAIFQAKKSFFWSR
KRTHSFVVNVLAQALYELFSATDDSLHQLRKACFLYFKLGGECVTGPVGLLSILSPHPLV
LIRHFFSVAIYATYFCFKSEPWATKPRALF

SE

 SE
PFAM accession number:PF08491
Interpro abstract (IPR013698):

This domain is found in squalene epoxidase (SE) and related proteins which are found in taxonomically diverse groups of eukaryotes and also in bacteria. SE was first cloned from Saccharomyces cerevisiae (Baker's yeast) where it was named ERG1. It contains a putative FAD binding site and is a key enzyme in the sterol biosynthetic pathway [ (PUBMED:9161422) ]. Putative transmembrane regions are found to the protein's C terminus.

GO process:oxidation-reduction process (GO:0055114)
GO component:integral component of membrane (GO:0016021)
GO function:squalene monooxygenase activity (GO:0004506), flavin adenine dinucleotide binding (GO:0050660)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry SE