SMART: Pfam domain SF3A3

The domain within your query sequence starts at position 129 and ends at position 207; the E-value for the SF3A3 domain shown below is 7.9e-27.

EFTDEEGYGRYLDLHDCYLKYINLKASEKLDYITYLSIFDQLFDIPKERKNAEYKRYLEM
LLEYLQDYTDRVKPLQDQN

SF3A3

PFAM accession number:	PF16837
Interpro abstract (IPR031774):	This entry represents a domain found in the SF3A3 protein, which is s component of the SF3a splicing factor complex of the mature U2 snRNP (small nuclear ribonucleoprotein particle). This domain can also be found in SF3A3 yeast homologues, Prp9 and Sap61. In budding yeasts, SF3a complex shows a bifurcated assembly structure of three subunits, Prp9 (subunit 3), Prp11 (subunit 2) and Prp21 (subunit 1). Prp9 and Prp21 were not thought to interact with each other but the alpha1 helix of Prp9 does make important contacts with the SURP2 domain of Prp21, thus the two do interact via a bidentate-binding mode. Prp9 harbours a major binding site for stem-loop IIa of U2 snRNA [ (PUBMED:22314233) ].

PFAM accession number:

PF16837

Interpro abstract (IPR031774):

This entry represents a domain found in the SF3A3 protein, which is s component of the SF3a splicing factor complex of the mature U2 snRNP (small nuclear ribonucleoprotein particle). This domain can also be found in SF3A3 yeast homologues, Prp9 and Sap61.

In budding yeasts, SF3a complex shows a bifurcated assembly structure of three subunits, Prp9 (subunit 3), Prp11 (subunit 2) and Prp21 (subunit 1). Prp9 and Prp21 were not thought to interact with each other but the alpha1 helix of Prp9 does make important contacts with the SURP2 domain of Prp21, thus the two do interact via a bidentate-binding mode. Prp9 harbours a major binding site for stem-loop IIa of U2 snRNA [ (PUBMED:22314233) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry SF3A3