SMART: Pfam domain SF3b10

The domain within your query sequence starts at position 3 and ends at position 80; the E-value for the SF3b10 domain shown below is 3.5e-43.

DRYTIHSQLEHLQSKYIGTGHADTTKWEWLVNQHRDSYCSYMGHFDLLNYFAIAENESKA
RVRFNLMEKMLQPSGPPA

SF3b10

PFAM accession number:	PF07189
Interpro abstract (IPR009846):	This family consists of several eukaryotic splicing factor 3B subunit 5 (SF3b5) proteins. SF3b5 is a 10kDa subunit of the splicing factor SF3b. SF3b associates with the splicing factor SF3a and a 12S RNA unit to form the U2 small nuclear ribonucleoproteins complex. SF3b5 and SF3b14b are also thought to facilitate the interaction of U2 with the branch site [ (PUBMED:12234937) ]. Also included in this entry is RDS3 complex subunit 10, another protein involved in mRNA splicing [ (PUBMED:15565172) ].

PFAM accession number:

PF07189

Interpro abstract (IPR009846):

This family consists of several eukaryotic splicing factor 3B subunit 5 (SF3b5) proteins. SF3b5 is a 10kDa subunit of the splicing factor SF3b. SF3b associates with the splicing factor SF3a and a 12S RNA unit to form the U2 small nuclear ribonucleoproteins complex. SF3b5 and SF3b14b are also thought to facilitate the interaction of U2 with the branch site [ (PUBMED:12234937) ]. Also included in this entry is RDS3 complex subunit 10, another protein involved in mRNA splicing [ (PUBMED:15565172) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry SF3b10