The domain within your query sequence starts at position 19 and ends at position 77; the E-value for the SFTA2 domain shown below is 1.5e-37.
AGPKVTLQVKLTETFQDKTSQNSSALDMLQKICLLLHLPSGTNVTLLHKGPPHYLTCRA
SFTA2 |
---|
PFAM accession number: | PF15210 |
---|---|
Interpro abstract (IPR028198): | This family of proteins are predicted to possess a signal peptide, indicating that they are secreted [ (PUBMED:15340161) ]. They are found in eukaryotes. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry SFTA2