SMART: Pfam domain SGTA

The domain within your query sequence starts at position 3 and ends at position 64; the E-value for the SGTA_dimer domain shown below is 2.5e-23.

NRKRLAYAIIQFLHGQLRHGGLSCDAQESLEVAIQCLETAFGVTLEDSDLALPQTLPEIF
EA

SGTA_dimer

PFAM accession number:	PF16546
Interpro abstract (IPR032374):	This entry represents a short N-terminal domain at the start of small glutamine-rich tetratricopeptide repeat-containing protein (SGTA), a heat-shock protein (HSP) co-chaperone involved in the targeting of tail-anchor membrane proteins to the endoplasmic reticulum. This is the homodimerisation domain that mediates the association with a single copy of Get4 or Get5 proteins, providing a link to the rest of the GET pathway [ (PUBMED:23142665) ].

PFAM accession number:

PF16546

Interpro abstract (IPR032374):

This entry represents a short N-terminal domain at the start of small glutamine-rich tetratricopeptide repeat-containing protein (SGTA), a heat-shock protein (HSP) co-chaperone involved in the targeting of tail-anchor membrane proteins to the endoplasmic reticulum. This is the homodimerisation domain that mediates the association with a single copy of Get4 or Get5 proteins, providing a link to the rest of the GET pathway [ (PUBMED:23142665) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry SGTA_dimer