The domain within your query sequence starts at position 1 and ends at position 98; the E-value for the SH3BGR domain shown below is 1.9e-50.
MVIKVFVATSSGSIAIRKKQQEVVGFLEANKIDFKELDIAGDEDNRKWMRENVPGEKKPQ NGIPLPPQIFNEEQYCGDFDSFFSAKEENIIYSFLGLA
SH3BGR |
---|
PFAM accession number: | PF04908 |
---|---|
Interpro abstract (IPR006993): | This family of proteins, which contains SH3BGRL3, is functionally uncharacterised. SH3BGRL3 is a highly conserved small protein, which is widely expressed and shows a significant similarity to glutaredoxin 1 (GRX1) of Escherichia coli which is predicted to belong to the thioredoxin superfamily. However, SH3BGRL3 lacks both conserved cysteine residues, which characterise the enzymatic active site of GRX. This structural feature raises the possibility that SH3BGRL3 and its homologues could function as endogenous modulators of GRX activity [ (PUBMED:11444877) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry SH3BGR