SMART: Pfam domain SH3

The domain within your query sequence starts at position 98 and ends at position 165; the E-value for the SH3_3 domain shown below is 5.8e-10.

AGLRIRSHPSLQSEQIGIVRVNGTITFIDEIHNDDGVWLRLNEETIKKYVPNMNGYTEAW
CLSFNQHL

SH3_3

PFAM accession number:	PF08239
Interpro abstract (IPR003646):	SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [ (PUBMED:15335710) (PUBMED:11256992) ]. They are found in a great variety of intracellular or membrane-associated proteins [ (PUBMED:1639195) (PUBMED:14731533) (PUBMED:7531822) ] for example, in a variety of proteins with enzymatic activity, in adaptor proteins, such as fodrin and yeast actin binding protein ABP-1. The SH3 domain has a characteristic fold which consists of five or six beta-strands arranged as two tightly packed anti-parallel beta sheets. The linker regions may contain short helices. The surface of the SH3-domain bears a flat, hydrophobic ligand-binding pocket which consists of three shallow grooves defined by conservative aromatic residues in which the ligand adopts an extended left-handed helical arrangement. The ligand binds with low affinity but this may be enhanced by multiple interactions. The region bound by the SH3 domain is in all cases proline-rich and contains PXXP as a core-conserved binding motif. The function of the SH3 domain is not well understood but they may mediate many diverse processes such as increasing local concentration of proteins, altering their subcellular location and mediating the assembly of large multiprotein complexes [ (PUBMED:7953536) ]. SH3 domains are widespread among metazoan intracellular signalling proteins and typically bind proline-rich polypeptides. This SH3 domain is a prokaryotic homologue. It might have two possible functions: (1) promoting survival of a pathogen within the invaded cell by modulating pathways controlled by SH3 domains; or (2) promoting invasion by binding to receptors on eukaryotic cells [ (PUBMED:10322416) (PUBMED:10369758) ].

PFAM accession number:

PF08239

Interpro abstract (IPR003646):

SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [ (PUBMED:15335710) (PUBMED:11256992) ]. They are found in a great variety of intracellular or membrane-associated proteins [ (PUBMED:1639195) (PUBMED:14731533) (PUBMED:7531822) ] for example, in a variety of proteins with enzymatic activity, in adaptor proteins, such as fodrin and yeast actin binding protein ABP-1.

The SH3 domain has a characteristic fold which consists of five or six beta-strands arranged as two tightly packed anti-parallel beta sheets. The linker regions may contain short helices. The surface of the SH3-domain bears a flat, hydrophobic ligand-binding pocket which consists of three shallow grooves defined by conservative aromatic residues in which the ligand adopts an extended left-handed helical arrangement. The ligand binds with low affinity but this may be enhanced by multiple interactions. The region bound by the SH3 domain is in all cases proline-rich and contains PXXP as a core-conserved binding motif. The function of the SH3 domain is not well understood but they may mediate many diverse processes such as increasing local concentration of proteins, altering their subcellular location and mediating the assembly of large multiprotein complexes [ (PUBMED:7953536) ].

SH3 domains are widespread among metazoan intracellular signalling proteins and typically bind proline-rich polypeptides. This SH3 domain is a prokaryotic homologue. It might have two possible functions: (1) promoting survival of a pathogen within the invaded cell by modulating pathways controlled by SH3 domains; or (2) promoting invasion by binding to receptors on eukaryotic cells [ (PUBMED:10322416) (PUBMED:10369758) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry SH3_3