The domain within your query sequence starts at position 2601 and ends at position 2700; the E-value for the SHR-BD domain shown below is 8.4e-10.
VFSHFVICNDTQETLRFGQVDTDENILLASLHSHQYSWRSHKSPQLLHICIEGWGNWRWS EPFTVDHAGTFIRTIQYKGRTASLIIKVRALSGVQKQIII
SHR-BD |
---|
PFAM accession number: | PF06650 |
---|---|
Interpro abstract (IPR009543): | This entry represents a domain, known as SHR-BD, found in vacuolar protein sorting-associated protein 13 (VPS13). In plants, this domain is found to be the region which interacts with SHR or the SHORT-ROOT transcription factor, a regulator of root-growth and asymmetric cell division that separates ground tissue into endodermis and cortex. The plant protein containing the SHR-BD is named SHRUBBY or SHBY ( Q9FT44 ) [ (PUBMED:2344435) ]. Proteins containing this domain may play a role in the control of protein cycling through the trans-Golgi network. Vacuolar sorting protein is an ATPase required for endosomal trafficking [ (PUBMED:10637304) ]. Defects in the human protein VPS13A cause chorea-acanthocytosis, an autosomal recessive neurodegenerative disorder characterised by the gradual onset of hyperkinetic movements and abnormal erythrocyte morphology [ (PUBMED:11381253) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry SHR-BD