SMART: Pfam domain SHR-BD

The domain within your query sequence starts at position 3271 and ends at position 3555; the E-value for the SHR-BD domain shown below is 4.2e-86.

CRAEGSLKIFISAPYWLINKTGLPLIFRQDNAKTDAAGQFEEHELARSLSPLLFCYADKE
QPNLCTMRIGRGIHPEGMPGWCQGFSLDGGSGVRALKVIQQGNRPGLIYNIGIDVKKGRG
RYIDTCMVIFAPRYLLDNKSSHKLAFAQREFARGQGTANPNGYISTLPGSSVVFHWPRND
YDQLLCVRLMDVPNCIWSGGFEVNKNNSFHINMRDTLGKCFFLRVEITLRGATYRISFSD
TDQLPPPFRIDNFSKVPVVFTQHGVAEPRLRTEVKPMMSLDYAWD

SHR-BD

PFAM accession number:	PF06650
Interpro abstract (IPR009543):	This entry represents a domain, known as SHR-BD, found in vacuolar protein sorting-associated protein 13 (VPS13). In plants, this domain is found to be the region which interacts with SHR or the SHORT-ROOT transcription factor, a regulator of root-growth and asymmetric cell division that separates ground tissue into endodermis and cortex. The plant protein containing the SHR-BD is named SHRUBBY or SHBY ( Q9FT44 ) [ (PUBMED:2344435) ]. Proteins containing this domain may play a role in the control of protein cycling through the trans-Golgi network. Vacuolar sorting protein is an ATPase required for endosomal trafficking [ (PUBMED:10637304) ]. Defects in the human protein VPS13A cause chorea-acanthocytosis, an autosomal recessive neurodegenerative disorder characterised by the gradual onset of hyperkinetic movements and abnormal erythrocyte morphology [ (PUBMED:11381253) ].

PFAM accession number:

PF06650

Interpro abstract (IPR009543):

This entry represents a domain, known as SHR-BD, found in vacuolar protein sorting-associated protein 13 (VPS13). In plants, this domain is found to be the region which interacts with SHR or the SHORT-ROOT transcription factor, a regulator of root-growth and asymmetric cell division that separates ground tissue into endodermis and cortex. The plant protein containing the SHR-BD is named SHRUBBY or SHBY ( Q9FT44 ) [ (PUBMED:2344435) ].

Proteins containing this domain may play a role in the control of protein cycling through the trans-Golgi network. Vacuolar sorting protein is an ATPase required for endosomal trafficking [ (PUBMED:10637304) ]. Defects in the human protein VPS13A cause chorea-acanthocytosis, an autosomal recessive neurodegenerative disorder characterised by the gradual onset of hyperkinetic movements and abnormal erythrocyte morphology [ (PUBMED:11381253) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry SHR-BD