The domain within your query sequence starts at position 142 and ends at position 286; the E-value for the SIR2_2 domain shown below is 7.8e-20.
TMVLTTNYDNLLEIFGQQQSKPMESLDLKDKTKVLQWARGHIKYGVLHIHGLYTDPCGMV LDPSGYKDVTQDPEVMEVLQNLYRTKSFLFVGCGETLRDQIFQALFLYSVPNKVDLEHYM VVLKENEDHFFKHQADMLLHGIKVV
SIR2_2 |
![]() |
---|
PFAM accession number: | PF13289 |
---|---|
Interpro abstract (IPR039444): | Cajal bodies are specialized compartments in the nucleus that are involved in the biogenesis of small nuclear ribonucleoproteins (snRNPs). FAM118B is a component of Cajal bodies that plays an important role in Cajal body formation, snRNP biogenesis and cell viability [ (PUBMED:24569877) ]. FAM118A has been identified as a gene expressed in glioblastoma stem cells, but not expressed in neural stem cells [ (PUBMED:26295306) ]. Its function is unkown. This entry represents a domain found in a group of proteins that are related to the sirtuins. Proteins containing this domain include FAM118A and FAM118B. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry SIR2_2