SMART: Pfam domain SIR2

The domain within your query sequence starts at position 75 and ends at position 225; the E-value for the SIR2_2 domain shown below is 7.7e-18.

AAIDFDLLEDEESKKFQKCLHEDKNLVHVAHDLIQKLSPVLEWAQEKRKLSVLHIHGVYT
NPSGIVLHPAGYQNVLRNTEVMREIQKLYENKSFLFLGCGWTVDDTTFQALFLEAVKHKS
DLEHFMLVRRGDVDEFKKLRENMLDKGIKVI

SIR2_2

PFAM accession number:	PF13289
Interpro abstract (IPR039444):	Cajal bodies are specialized compartments in the nucleus that are involved in the biogenesis of small nuclear ribonucleoproteins (snRNPs). FAM118B is a component of Cajal bodies that plays an important role in Cajal body formation, snRNP biogenesis and cell viability [ (PUBMED:24569877) ]. FAM118A has been identified as a gene expressed in glioblastoma stem cells, but not expressed in neural stem cells [ (PUBMED:26295306) ]. Its function is unkown. This entry represents a domain found in a group of proteins that are related to the sirtuins. Proteins containing this domain include FAM118A and FAM118B.

PFAM accession number:

PF13289

Interpro abstract (IPR039444):

Cajal bodies are specialized compartments in the nucleus that are involved in the biogenesis of small nuclear ribonucleoproteins (snRNPs). FAM118B is a component of Cajal bodies that plays an important role in Cajal body formation, snRNP biogenesis and cell viability [ (PUBMED:24569877) ].

FAM118A has been identified as a gene expressed in glioblastoma stem cells, but not expressed in neural stem cells [ (PUBMED:26295306) ]. Its function is unkown.

This entry represents a domain found in a group of proteins that are related to the sirtuins. Proteins containing this domain include FAM118A and FAM118B.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry SIR2_2