The domain within your query sequence starts at position 534 and ends at position 665; the E-value for the SIS domain shown below is 1.2e-29.

ELYTQRSLLVMGRGYNYATCLEGALKIKEITYMHSEGILAGELKHGPLALVDKQMPVIMV
IMKDPCFAKCQNALQQVTARQGRPIILCSKDDTESSKFAYKTIELPHTVDCLQGILSVIP
LQLLSFHLAVLR

SIS

 SIS
PFAM accession number:PF01380
Interpro abstract (IPR001347):

The sugar isomerase (SIS) domain is a phosphosugar-binding module that is found in a variety of eubacterial, archaebacterial and eukaryotic proteins that have a role in phosphosugar isomerization or regulation [ (PUBMED:10203754) ]. In enzymes, the SIS domain can have a catalytic function as an isomerase and bind to phosphorylated sugars. In bacterial transcriptional regulators of the rpiR family, the domain seems to bind substrates implicated in the genes for sugar metabolism that are controlled by the regulator. The SIS domain is found in one or two copies and can be linked to additional domains, such as helix-turn-helix (HTH), CBS, glutamine amidotransferases type 2, or phosphopantetheine-attachment [ (PUBMED:10203754) (PUBMED:18049859) ].

The SIS domain has an alpha-beta structure and is dominated by a five-stranded parallel beta sheet flanked on either side by alpha helices forming a three- layer alpha-beta-alpha sandwich [ (PUBMED:9739095) ]. The fold shows similarities to that of glucose-6-phosphate isomerase.

GO process:carbohydrate derivative metabolic process (GO:1901135)
GO function:carbohydrate derivative binding (GO:0097367)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry SIS