The domain within your query sequence starts at position 165 and ends at position 223; the E-value for the SLD5_C domain shown below is 4.1e-21.

PDLDSYVFLRVKERQENILVEPEADEQRDYVIDLEVGSQHLIRYKTIAPLVASGAVQLI

SLD5_C

 SLD5_C
PFAM accession number:PF16922
Interpro abstract (IPR031633):

The C-terminal domain of DNA replication complex GINS protein SLD5 is important in the assembly of the GINS complex, a complex which is involved in initiation of DNA replication and progression of DNA replication forks [ (PUBMED:17417653) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry SLD5_C