The domain within your query sequence starts at position 32 and ends at position 106; the E-value for the SLT_beta domain shown below is 3.4e-9.
VAKWELSVKLHDEDHTVVASNNGPAFTVEVDGSKLNVTSTWNLASPLLSVNVDGTQRTVQ CLSREAGGNMSIQFL
SLT_beta |
 |
|---|
| PFAM accession number: | PF02258 |
|---|---|
| Interpro abstract (IPR003189): | This family represents the B subunit of shiga-like toxin (SLT or verotoxin) produced by some strains of Escherichia coli associated with hemorrhagic colitis and hemolytic uremic syndrome. SLT s are composed of one enzymatic A subunit and five cell binding B subunits [ (PUBMED:10745005) ]. |
| GO process: | hemolysis by symbiont of host erythrocytes (GO:0019836) |
| GO component: | extracellular region (GO:0005576) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry SLT_beta