The domain within your query sequence starts at position 19 and ends at position 174; the E-value for the SLY domain shown below is 1.9e-51.
KLSLQRSSSFKDFAKSKPSSPVVSEKEFNLDDNIPEDDSGVLTPEDSGKSGKKLGKKWRA VISRTMNRKMGKMMVKALSEEMGDTLEEGSASPTSPDCSLDSPGPEKMALAFTEQEEREP PSLSRQTSTGSELCSPGPGSGSFLEESPAPQYTGPF
SLY |
---|
PFAM accession number: | PF12485 |
---|---|
Interpro abstract (IPR021090): | This entry represents eukaryotic proteins that are typically between 144 and 156 amino acids in length. The entry is found in association with . There is a conserved LGKK sequence motif. SAM/SH3 domain-containing proteins contain a Src homology 3 domain and a sterile alpha motif, suggesting that they may function as a signaling adaptor protein in lymphocytes [ (PUBMED:11470164) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry SLY