The domain within your query sequence starts at position 128 and ends at position 194; the E-value for the SMK-1 domain shown below is 3e-27.
LENEGYIKKLLQLFQACENLENTEGLHHLYEIIRGILFLNKATLFEVMFSDECIMDVVGC LEYDPAL
SMK-1 |
![]() |
---|
PFAM accession number: | PF04802 |
---|---|
Interpro abstract (IPR006887): | This is a conserved region which characterises a number of eukaryotic proteins of unknown function. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry SMK-1