The domain within your query sequence starts at position 179 and ends at position 254; the E-value for the SNF5 domain shown below is 1.1e-27.
NASQPEVLVPIRLDMEIDGQKLRDAFTWNMNEKLMTPEMFSEILCDDLDLNPLTFVPAIA SAIRQQIESYPTDSIL
SNF5 |
---|
PFAM accession number: | PF04855 |
---|---|
Interpro abstract (IPR006939): | SNF5 is a component of the yeast SWI/SNF complex, which is an ATP-dependent nucleosome-remodelling complex that regulates the transcription of a subset of yeast genes. SNF5 is a key component of all SWI/SNF-class complexes characterised so far [ (PUBMED:10325430) ]. This family consists of the conserved region of SNF5, including a direct repeat motif. SNF5 is essential for the assembly promoter targeting and chromatin remodelling activity of the SWI-SNF complex [ (PUBMED:11390659) ]. SNF5 is also known as SMARCB1, for SWI/SNF-related, matrix-associated, actin-dependent regulator of chromatin, subfamily b, member 1, and also INI1 for integrase interactor 1. Loss-of function mutations in SNF5 are thought to contribute to oncogenesis in malignant rhabdoid tumours (MRTs) [ (PUBMED:9671307) ]. |
GO process: | chromatin remodeling (GO:0006338) |
GO component: | nuclear chromosome (GO:0000228) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry SNF5