The domain within your query sequence starts at position 198 and ends at position 307; the E-value for the SPARC_Ca_bdg domain shown below is 1.3e-33.
KSACTDKELRNLASRLKDWFGALHEDANRVIKPTSSDPAQGRFDTSILPICKDSLGWMFN KLDMNYDLLLDHSEINAIYLDKYEPCIKPLFNSCDSFKDGKLSNNEWCYC
SPARC_Ca_bdg |
![]() |
---|
PFAM accession number: | PF10591 |
---|---|
Interpro abstract (IPR019577): | This entry represents the calcium-binding domain found in SPARC (Secreted Protein Acidic and Rich in Cysteine) and Testican (also known as SPOCK; or SParc/Osteonectin, Cwcv and Kazal-like domains) proteins. SPARC proteins are down-regulated in various tumours and may have a tumour-suppressor function [ (PUBMED:18459035) (PUBMED:17325739) ]. Testican-3 appears to be a novel regulator that reduces the activity of matrix metalloproteinase (MMP) in adult T-cell leukemia (ATL) [ (PUBMED:19144404) ]. This cysteine-rich domain is responsible for the anti-spreading activity of human urothelial cells. This extracellular calcium-binding domain is rich in alpha-helices and contains two EF-hands that each coordinates one Ca2+ ion, forming a helix-loop-helix structure that not only drives the conformation of the protein but is also necessary for biological activity. The anti-spreading activity was dependent on the coordination of Ca2+ by a Glu residue at the Z position of EF-hand 2 [ (PUBMED:16121393) ]. |
GO function: | calcium ion binding (GO:0005509) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry SPARC_Ca_bdg