The domain within your query sequence starts at position 128 and ends at position 230; the E-value for the SPATIAL domain shown below is 2.4e-20.
QPMDLTPSADIAGKPVCVVRDEFSLSALTQPTFLSRCLMGMPTISVPIGDPQSNRNPQLS TSDTWRKKLKDLASRVTVFTKEIQPKPDEVGVAQRMEPRKKRP
SPATIAL |
---|
PFAM accession number: | PF15256 |
---|---|
Interpro abstract (IPR037394): | This family includes uncharacterised protein C4orf17 and TBATA, also known as Spatial or C4orf17-like. TBATA may be involved in spermatid differentiation [ (PUBMED:17196196) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry SPATIAL