The domain within your query sequence starts at position 4 and ends at position 173; the E-value for the SPC22 domain shown below is 1.9e-60.

VLSRANSLFAFSLSVMAALTFGCFITTAFKDRSVPVRLHVSRIMLKNVEDFTGPRERSDL
GFITFDITADLENIFDWNVKQLFLYLSAEYSTKNNALNQVVLWDKIVLRGDNPKLLLKDM
KTKYFFFDDGNGLKGNRNVTLTLSWNVVPNAGILPLVTGSGHVSVPFPDT

SPC22

 SPC22
PFAM accession number:PF04573
Interpro abstract (IPR007653):

This entry includes signal peptidase complex subunit 3 (Spc3, also known as SPC22) and its homologues from fungi, plants and animals.

Translocation of polypeptide chains across the endoplasmic reticulum membrane is triggered by signal sequences. During translocation of the nascent chain through the membrane, the signal sequence of most secretory and membrane proteins is cleaved off. Cleavage occurs by the signal peptidase complex (SPC) which consists of four subunits in yeast and five in mammals [ (PUBMED:8632014) (PUBMED:9148931) ].

GO process:signal peptide processing (GO:0006465)
GO component:integral component of membrane (GO:0016021), signal peptidase complex (GO:0005787)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry SPC22