The domain within your query sequence starts at position 319 and ends at position 437; the E-value for the SPG48 domain shown below is 2.9e-45.
LQKACLVEAVSVLDVLCRQDPSFLYRTLSCLKALHRRLGEDPGSERALVPLAQFFLNHGE AAAMDAEAVYGQLLRGLPSERFHSPTLAFEVIHFCTHNLALFDSHFLSLLRLSFPSLFK
SPG48 |
 |
|---|
| PFAM accession number: | PF14764 |
|---|---|
| Interpro abstract (IPR028222): | AP-5 complex subunit zeta-1 is a component of the fifth Adaptor-Protein complex (AP-5) [ (PUBMED:22022232) ]. Adaptor protein (AP) complexes facilitate the trafficking of cargo from one membrane compartment of the cell to another by recruiting other proteins to particular types of vesicles. AP-5 is involved in trafficking proteins from endosomes towards other membranous compartments [ (PUBMED:22022230) ]. There are genetic links between AP-5 and hereditary spastic paraplegia, a group of human genetic disorders characterised by progressive spasticity in the lower limbs [ (PUBMED:20613862) ]. |
| GO component: | AP-5 adaptor complex (GO:0044599) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry SPG48