The domain within your query sequence starts at position 175 and ends at position 433; the E-value for the SPO22 domain shown below is 3.8e-70.
ESAVAQGDFKKASMCVLRCKDMLMRLPNMTKYLHVLCYNLGIEASKRNKYKESSFWLGQS YEIGKMDRRSVEPQMLAKTLRLLATIYLNCGGEAYYTKAFIAILIANKEHLHPAGLFLKM RILMKGNSCNEELLEAAKEILYLAMPLEFYLSIIQFLIDNKRESVGFRFLRIISDNFKSP EDRKRILLFYIDTLLQKDQDMIAEEKIKDVLKGYQTRSRLSRDLVNWLHNILWGKASRSV KVQKYADALHWYSYSLKLY
SPO22 |
![]() |
---|
PFAM accession number: | PF08631 |
---|---|
Interpro abstract (IPR013940): | This entry includes a group of meiosis specific proteins, including Spo22 from budding yeasts, ZIP4 from plants and TEX11 from mammals. They play an important role in normal crossover formation and meiotic chromosome segregation [ (PUBMED:18348867) (PUBMED:16740482) (PUBMED:18369460) ]. Impairment of these functions results in meiosis I (MI) segregation defect [ (PUBMED:18369460) ]. |
GO process: | meiotic cell cycle (GO:0051321) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry SPO22