The domain within your query sequence starts at position 485 and ends at position 629; the E-value for the SPRY domain shown below is 6.4e-13.

RHYWEVEVGGRRGWAVGAARESTHHKEKVGSGGSSVSSGDASSSRHHHRRRRLHLPQQLL
LQREVWCVGTHGKRYQAQSSTEQTLLSPCEKPRRFGVYLDYEAGRLGFYNADTLAHVHTF
SAAFLGERVFPFFRVLSKGTRIKLC

SPRY

SPRY
PFAM accession number:PF00622
Interpro abstract (IPR003877):

The SPRY domain is named from SPla and the RYanodine Receptor. Its function is unknown. Distant homologues are domains in butyrophilin/marenostrin/pyrin [ (PUBMED:9204703) ]. Ca 2+ -release from the sarcoplasmic or endoplasmic reticulum, the intracellular Ca 2+ store, is mediated by the ryanodine receptor (RyR) and/or the inositol trisphosphate receptor (IP3R).

GO function:protein binding (GO:0005515)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry SPRY