The domain within your query sequence starts at position 1 and ends at position 106; the E-value for the SRTM1 domain shown below is 3.6e-59.
MSEADSSSGFAGSVENGTFLELFPTSLSTSVDSSSGHLSNVYIYVSIFLSLLAFLLLLLI IALQRLKNIISSSSSYPEYPSDAGSSFTNLEVCSISSQRSTFSNLS
SRTM1 |
 |
|---|
| PFAM accession number: | PF15872 |
|---|---|
| Interpro abstract (IPR031741): | This family of uncharacterised proteins is found in chordates. Proteins in this family are approximately 100 amino acids in length. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry SRTM1