The domain within your query sequence starts at position 49 and ends at position 81; the E-value for the SSXRD domain shown below is 1.8e-19.
KLRKKNVEVKMYRLRERKGLAYEEVSEPQDDDY
SSXRD |
 |
|---|
| PFAM accession number: | PF09514 |
|---|---|
| Interpro abstract (IPR019041): | Protein SSX1 can repress transcription, and this has been attributed to a putative Kruppel associated box (KRAB) repression domain at the N terminus. However, from the analysis of these deletion constructs further repression activity was found at the C terminus of SSX1. Which has been called the SSXRD (SSX Repression Domain). The potent repression exerted by full-length SSX1 appears to localise to this region [ (PUBMED:9788446) ]. |
| GO process: | regulation of transcription, DNA-templated (GO:0006355) |
| GO component: | nucleus (GO:0005634) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry SSXRD