The domain within your query sequence starts at position 13 and ends at position 74; the E-value for the SSXT domain shown below is 1.1e-34.
KGEITPAAIQKMLDENNHLIQCIMDYQNKGKASECSQYQQILHTNLVYLATIADSNQNMQ SL
SSXT |
![]() |
---|
PFAM accession number: | PF05030 |
---|---|
Interpro abstract (IPR007726): | SSXT (also known as SS18) appears to function synergistically with RBM14 as a transcriptional coactivator [ (PUBMED:15919756) ]. The SSXT protein is involved in synovial sarcoma in humans. A SYT-SSX fusion gene resulting from the chromosomal translocation t(X;18) (p11;q11) is characteristic of synovial sarcomas. This translocation fuses the SSXT (SYT) gene from chromosome 18 to either of two homologous genes at Xp11, SSX1 or SSX2 [ (PUBMED:12173050) ]. The SS18 family also includes SS18-like proteins 1 and 2, and GRF1-interacting factors from plants [ (PUBMED:19648231) ]. SS18-like protein 1 is transcriptional activator which is required for calcium-dependent dendritic growth and branching in cortical neurons [ (PUBMED:14716005) (PUBMED:19081374) ]. |
GO function: | transcription coactivator activity (GO:0003713) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry SSXT