The domain within your query sequence starts at position 472 and ends at position 556; the E-value for the SUI1 domain shown below is 1e-13.

KGKLCPIDITLALKTYNKKVTVVRNLETYGLDPCSVAAILQQRCQASTIVSPAPGAKDSL
QVQVQGNQIHHLGQLLLEEYRLPGK

SUI1

 SUI1
PFAM accession number:PF01253
Interpro abstract (IPR001950):

In budding yeast (Saccharomyces cerevisiae), SUI1 is a translation initiation factor that functions in concert with eIF-2 and the initiator tRNA-Met in directing the ribosome to the proper start site of translation [ (PUBMED:1729602) ]. SUI1 is a protein of 108 residues. Close homologues of SUI1 have been found [ (PUBMED:7904817) ] in mammals, insects and plants. SUI1 is also evolutionary related to:

  • Hypothetical proteins from bacteria such as Escherichia coli (yciH) or Haemophilus influenzae (HI1225).
  • Hypothetical proteins from archaea such as Methanococcus jannaschii (MJ0463).

Two eukaryotic proteins also seem to contain a C-terminal SUI1-like domain. These are:

  • Density-regulated protein (gene: DENR). This protein is found in mammals, insects, nematodes, plants and fungi.
  • Ligatin (gene: LGTN). This protein is found in mammals and insects.
GO process:translational initiation (GO:0006413)
GO function:translation initiation factor activity (GO:0003743)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry SUI1