The domain within your query sequence starts at position 474 and ends at position 554; the E-value for the SUI1 domain shown below is 1.1e-17.
KLCPIDITLALKTYNKKVTVVRNLETYGLDPCSVAAILQQRCQASTIVSPAPGAKDSLQV QVQGNQIHHLGQLLLEEYRLP
SUI1 |
---|
PFAM accession number: | PF01253 |
---|---|
Interpro abstract (IPR001950): | In budding yeast (Saccharomyces cerevisiae), SUI1 is a translation initiation factor that functions in concert with eIF-2 and the initiator tRNA-Met in directing the ribosome to the proper start site of translation [ (PUBMED:1729602) ]. SUI1 is a protein of 108 residues. Close homologues of SUI1 have been found [ (PUBMED:7904817) ] in mammals, insects and plants. SUI1 is also evolutionary related to:
Two eukaryotic proteins also seem to contain a C-terminal SUI1-like domain. These are:
|
GO process: | translational initiation (GO:0006413) |
GO function: | translation initiation factor activity (GO:0003743) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry SUI1