The domain within your query sequence starts at position 16 and ends at position 124; the E-value for the SURF4 domain shown below is 2e-43.
KSTSTVGGTCCLFLRVTKQYLPHVARLCLISTFLEDGIRMWFQWSEQRDYIDTTWSCGYL LASSFVFLNLLGQLTGCVLVLSRNFVQYACFGLFGIIALQTIAYSILWD
SURF4 |
---|
PFAM accession number: | PF02077 |
---|---|
Interpro abstract (IPR002995): | The surfeit locus gene SURF4 (or surf-4) encodes a conserved integral eukaryotic membrane protein of about 270 to 300 amino-acid residues that seems to be located in the endoplasmic reticulum [ (PUBMED:7540914) ]. |
GO component: | integral component of membrane (GO:0016021) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry SURF4