The domain within your query sequence starts at position 1 and ends at position 107; the E-value for the SVA domain shown below is 3.2e-42.
MQGLSFTFSAVTLFLVLCLQLGIIESQDDENVRKPLLIEIDVPSTAQENQEITVQVTVET QYRECMVIKAYLVSNEPMEGAFNYVQTRCLCNDHPIRFFWDIIITSK
SVA |
---|
PFAM accession number: | PF05326 |
---|---|
Interpro abstract (IPR007990): | Prolactin-inducible (PIP) is a 17kDa glycoprotein that binds to many proteins including fibrinogen, actin, keratin, myosin, immunoglobulin G, CD4, and human zinc-alpha-2 glycoprotein [ (PUBMED:22209935) ]. It forms a complex with human serum albumin (HSA) in seminal plasma and may affect male fertility/infertility [ (PUBMED:22209935) ]. It also acts as a factor capable of suppressing T-cell apoptosis through its interaction with CD4 [ (PUBMED:11178965) ]. |
GO component: | extracellular region (GO:0005576) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry SVA