The domain within your query sequence starts at position 5 and ends at position 148; the E-value for the SYS1 domain shown below is 4e-57.
FRSYVWDPLLILSQIVLMQTVYYGSLGLWLALVDALVRSSPSLDQMFDAEILGFSTPPGR LSMMSFVLNALTCALGLLYFIRRGKQCLDFTVTVHFFHLLGCWLYSSRFPSALTWWLVQA VCIALMAVIGEYLCMRTELKEIPL
SYS1 |
---|
PFAM accession number: | PF09801 |
---|---|
Interpro abstract (IPR019185): | Members of this family are integral membrane proteins involved in protein trafficking between the late Golgi and endosome. They may also serve as a receptor for ADP-ribosylation factor-related protein 1 (ARFRP1) [ (PUBMED:15203023) ]. Sys1p is a small integral membrane protein with four predicted transmembrane domains that localises to the Trans Golgi network TGN in yeast and human cells [ (PUBMED:16926193) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry SYS1