SMART: Pfam domain S

The domain within your query sequence starts at position 5 and ends at position 48; the E-value for the S_100 domain shown below is 1.5e-24.

LESAMETLINVFHAHSGKEGDKYKLSKKELKDLLQTELSGFLDV

S_100

PFAM accession number:	PF01023
Interpro abstract (IPR013787):	The calcium-binding domain found in S100 and CaBP-9k proteins is a subfamily of the EF-hand calcium-binding domain [ (PUBMED:15284904) ]. S100s are small dimeric acidic calcium and zinc-binding proteins abundant in the brain, with S100B playing an important role in modulating the proliferation and differentiation of neurons and glia cells [ (PUBMED:15006498) ]. S100 proteins have two different types of calcium-binding sites: a low affinity one with a special structure, and a 'normal' EF-hand type high-affinity site. Calbindin-D9k (CaBP-9k) also belong to this family of proteins, but it does not form dimers. CaBP-9k is a cytosolic protein expressed in a variety of tissues. Although its precise function is unknown, it appears to be under the control of the steroid hormones oestrogen and progesterone in the female reproductive system [ (PUBMED:16288660) ]. In the intestine, CaBP-9k may be involved in calcium absorption by mediating intracellular diffusion [ (PUBMED:12520541) ]. This entry represents a subdomain of the calcium-binding domain found in S100, CaBP-9k, and related proteins.

PFAM accession number:

PF01023

Interpro abstract (IPR013787):

The calcium-binding domain found in S100 and CaBP-9k proteins is a subfamily of the EF-hand calcium-binding domain [ (PUBMED:15284904) ]. S100s are small dimeric acidic calcium and zinc-binding proteins abundant in the brain, with S100B playing an important role in modulating the proliferation and differentiation of neurons and glia cells [ (PUBMED:15006498) ]. S100 proteins have two different types of calcium-binding sites: a low affinity one with a special structure, and a 'normal' EF-hand type high-affinity site.

Calbindin-D9k (CaBP-9k) also belong to this family of proteins, but it does not form dimers. CaBP-9k is a cytosolic protein expressed in a variety of tissues. Although its precise function is unknown, it appears to be under the control of the steroid hormones oestrogen and progesterone in the female reproductive system [ (PUBMED:16288660) ]. In the intestine, CaBP-9k may be involved in calcium absorption by mediating intracellular diffusion [ (PUBMED:12520541) ].

This entry represents a subdomain of the calcium-binding domain found in S100, CaBP-9k, and related proteins.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry S_100