The domain within your query sequence starts at position 56 and ends at position 160; the E-value for the Sacchrp_dh_C domain shown below is 8.7e-10.
FLFFVKFSIGRQLLIKMDETSFTMTFFGQGYSHGTCVEKNKPNIRICTQVKGPEAGYVAT PIAMVQAAMTFLSDASDLPKGGGVFTPGAAFSRTKLIDRLNKHGI
Sacchrp_dh_C |
 |
|---|
| PFAM accession number: | PF16653 |
|---|---|
| Interpro abstract (IPR032095): | This entry represents the C-terminal domain of saccharopine dehydrogenase and related proteins. In some organisms this enzyme is found as a bifunctional polypeptide with lysine ketoglutarate reductase. The saccharopine dehydrogenase can also function as a saccharopine reductase [ (PUBMED:8885833) (PUBMED:11080625) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Sacchrp_dh_C