The domain within your query sequence starts at position 23 and ends at position 278; the E-value for the Sarcoglycan_1 domain shown below is 3.2e-82.
KVGIYGWRKRCLYFFVLLLMILILVNLAMTIWILKVMNFTIDGMGNLRITEKGLKLEGDS EFLQPLYAKEIKSRPGNALYFKSARNVTVNILNDQTKVLTQLVTGPKAVEAYGKRFEVKT VSGKLLFSADDSEVVVGAERLRVLGAEGTVFPKSIETPNVRADPFKELRLESPTRSLVME APKGVEINAEAGNMEAICRSELRLESKDGEIKLDAAKIKLPRLPRGSYTPTGTRQKVFEV CVCANGRLFLSQAGTG
Sarcoglycan_1 |
---|
PFAM accession number: | PF04790 |
---|---|
Interpro abstract (IPR006875): | The dystrophin glycoprotein complex (DGC) is a membrane-spanning complex that links the interior cytoskeleton to the extracellular matrix in muscle. The sarcoglycan complex is a subcomplex within the DGC and is composed of several muscle-specific, transmembrane proteins (alpha-, beta-, gamma-, delta- and zeta-sarcoglycan). The sarcoglycans are asparagine-linked glycosylated proteins with single transmembrane domains. This family contains beta, gamma, delta and zeta members [ (PUBMED:12107060) (PUBMED:12189167) ]. |
GO component: | integral component of membrane (GO:0016021), sarcoglycan complex (GO:0016012) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Sarcoglycan_1