The domain within your query sequence starts at position 9 and ends at position 70; the E-value for the Scm3 domain shown below is 7.2e-13.

RRLHQQLKESSSRFQTLMKRLIAKYNQPFEDDPLVEMRTLTYETPQGLRVWGGKLMKKED
KE

Scm3

Scm3
PFAM accession number:PF10384
Interpro abstract (IPR018465):

This entry includes human holliday junction recognition protein (HJURP) and its homologue, Scm3 from budding yeasts.

HJURP is a histone chaperone that plays a central role in the incorporation and maintenance of histone H3-like variant CENP-A at centromeres [ (PUBMED:19410544) ].

Scm3 is a non-histone component of centromeric chromatin that binds to CenH3-H4 histones, which are required for kinetochore assembly. Scm3 is required for Cse4 (CENP- homologue) localisation and is required for its centromeric association [ (PUBMED:17574026) (PUBMED:17569568) ]. The histone H3 variant Cse4 replaces conventional histone H3 in centromeric chromatin and helps direct the assembly of the kinetochore. In addition, Scm3 has is required for G2/M progression [ (PUBMED:17548816) ] and is required to maintain kinetochore function throughout the cell cycle. Scm3 contains a nuclear export signal (NES). The N-terminal region of Scm3 is well conserved and functions as the CenH3-interacting domain, while the C-terminal region is variable in size and sometimes consists of DNA binding motifs [ (PUBMED:17704645) ].

GO component:nucleus (GO:0005634)
GO function:histone binding (GO:0042393)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Scm3