The domain within your query sequence starts at position 247 and ends at position 492; the E-value for the Sec16_C domain shown below is 4.8e-39.
KFTKLLYYGRKKEALEWAMKNHLWGHALFLASKMDPRTYNWVMSGFTSTLALNDPLQTLF QLMSGRIPQAATVCGDKQWGDWRPHLAVILSNQAGDTELYQRAIVSMGDTLAGKGLVEAS HFCYLMAHVPFGHYTVKTDHLALVGSSHSQEFMKFATIEAIQRTEIFEYCQMLGRPKSFI PSFQVYKLLYASRLADYGLASQALHYCEAIGAAVLSQEGSSHPVLLAELIKLAEKLKLSD PLVLER
Sec16_C |
![]() |
---|
PFAM accession number: | PF12931 |
---|---|
Interpro abstract (IPR024298): | Sec31 is a component of the COPII coat complex that mediates formation of transport vesicles from the ER. The central alpha-helical unit of Sec31 is structurally similar to four large architectural nucleoporins. This alpha-helical unit, common to COPII and nuclear pore complex proteins, has been termed the ancestral coatomer element 1 (ACE1) [ (PUBMED:18974315) ]. This entry represents the ACE1 element found in Sec31 and Sec16, which also contains an ACE1 [ (PUBMED:20696705) ]. The ACE1 element of Sec31 can functionally replace that of Sec16. Both Sec31 and Sec16 bind to Sec13 [ (PUBMED:20696705) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Sec16_C