The domain within your query sequence starts at position 130 and ends at position 277; the E-value for the Sec34 domain shown below is 9.5e-57.
MRDYLSGFQEQCDAILNDVNSALQHQESLQKQYLFVSNKTGTLHEACEQLLKEQSELADL AEHIQQKLSYFNELETINTKLNSPTLSVNSEGFIPMLAKLDDCITYISSHPNFKDYPVYL LKFKQCLSKALHLMKTYTVNTLQTLTNQ
Sec34 |
---|
PFAM accession number: | PF04136 |
---|---|
Interpro abstract (IPR007265): | Sec34 and Sec35 form a sub-complex in a seven-protein complex that includes Dor1. This complex is thought to be important for tethering vesicles to the Golgi [ (PUBMED:11703943) ]. |
GO process: | intracellular protein transport (GO:0006886) |
GO component: | membrane (GO:0016020), cis-Golgi network (GO:0005801) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Sec34