The domain within your query sequence starts at position 1 and ends at position 177; the E-value for the Sec6 domain shown below is 7.7e-29.
MPILKSLGVGDPKVPRAGTLPLRSSRNPFEDTPTLEEEDAELGTLPNGTSCRRRATLEKL AGLAPFRLGWTSGRRAGSPGDGQVRSFLGRVLAPGIRRSSADFGLLNRLQGFRTHGDEEP AGEAARRLAFLRLGRGPKPRRASLAERLVPAGEAAPEPPPKVPEPPKIKEPLSVLEI
Sec6 |
![]() |
---|
PFAM accession number: | PF06046 |
---|---|
Interpro abstract (IPR010326): | Sec6 is a component of the multiprotein exocyst complex. Sec6 interacts with Sec8, Sec10 and Exo70. These exocyst proteins localise to regions of active exocytosis-at the growing ends of interphase cells and in the medial region of cells undergoing cytokinesis-in an F-actin-dependent and exocytosis-independent manner [ (PUBMED:11854409) ]. |
GO process: | exocytosis (GO:0006887) |
GO component: | exocyst (GO:0000145) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Sec6