The domain within your query sequence starts at position 7 and ends at position 137; the E-value for the Sedlin_N domain shown below is 7.3e-38.
VIAKENYPLYIRSTPTESELKFHYMVHTSLDVVDEKISAMGKALVDQRELYLGLLYPTED YKVYGYVTNSKVKFVMVVDSSNTALRDNEIRSMFRKLHNSYTDVMCNPFYNPGDRIQSRA FDTMVTSMMIQ
Sedlin_N |
---|
PFAM accession number: | PF04628 |
---|---|
Interpro abstract (IPR006722): | Trafficking protein particle complex subunit 2, also known as Sedlin, is a 140 amino-acid protein with a putative role in endoplasmic reticulum-to-Golgi transport [ (PUBMED:20498720) ]. Several missense mutations and deletion mutations in the SEDL gene, which result in protein truncation by frame shift, are responsible for spondyloepiphyseal dysplasia tarda, a progressive skeletal disorder (OMIM:313400) [ (PUBMED:11349230) ]. |
GO process: | endoplasmic reticulum to Golgi vesicle-mediated transport (GO:0006888) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Sedlin_N