The domain within your query sequence starts at position 9 and ends at position 136; the E-value for the Sedlin_N domain shown below is 1e-50.

IVGHHDNPVFEMEFLPAGKAESKDEHRHLNQFIAHAALDLVDENMWLSNNMYLKTVDKFN
EWFVSAFVTAGHMRLIMLHDVRHEDGIKNFFTDVYDLYIKFAMNPFYEPNSPIRSSAFER
KVQFLGKK

Sedlin_N

• PFAM accession number: PF04628
• Interpro abstract (IPR006722):

  Trafficking protein particle complex subunit 2, also known as Sedlin, is a 140 amino-acid protein with a putative role in endoplasmic reticulum-to-Golgi transport [ (PUBMED:20498720) ]. Several missense mutations and deletion mutations in the SEDL gene, which result in protein truncation by frame shift, are responsible for spondyloepiphyseal dysplasia tarda, a progressive skeletal disorder (OMIM:313400) [ (PUBMED:11349230) ].

• GO process: endoplasmic reticulum to Golgi vesicle-mediated transport (GO:0006888)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Sedlin_N