The domain within your query sequence starts at position 430 and ends at position 617; the E-value for the Senescence domain shown below is 3.8e-56.
NILSGASWVSWGLVKGAEFTGKAIQKGASKLRERIQPEEKPVEVSPAVTRGLYIAKQATG GAAKVSQLLVDGVCTVANCVGKELAPHVKKHGSKLVPESLKRDKDGKSALDGAMVVAASS VQGFSTVWQGLECAAKCIVNNVSAETVQTVRYKYGHNAGEATHNAVDSAINVGLTAYNID NIGIKAMV
Senescence |
![]() |
---|
PFAM accession number: | PF06911 |
---|---|
Interpro abstract (IPR009686): | This domain is found in a number of plant senescence-associated proteins of approximately 450 residues in length. In Hemerocallis, petals have a genetically based program that leads to senescence and cell death approximately 24 hours after the, flower opens, and it is believed that senescence proteins produced around that time have a role in this program [ (PUBMED:10412903) ]. This domain is also found in a number of Spartin proteins which may be implicated in endosomal trafficking, or microtubule dynamics, or both [ (PUBMED:12676568) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Senescence