The domain within your query sequence starts at position 80 and ends at position 112; the E-value for the Sgf11 domain shown below is 1.1e-21.
KSKECVCPNCSRSIAASRFAPHLEKCLGMGRNS
Sgf11 |
---|
PFAM accession number: | PF08209 |
---|---|
Interpro abstract (IPR013246): | The Sgf11 (SAGA-associated factor 11) family is a SAGA complex subunit in Saccharomyces cerevisiae (Baker's yeast). The SAGA complex is a multisubunit protein complex involved in transcriptional regulation. SAGA combines proteins involved in interactions with DNA-bound activators and TATA-binding protein (TBP), as well as enzymes for histone acetylation and deubiquitylation [ (PUBMED:15657441) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Sgf11