The domain within your query sequence starts at position 712 and ends at position 1011; the E-value for the Sin3a_C domain shown below is 7.2e-81.
FFANNNWYFFLRLHQTLCARLLKIYRQAQKQLLEHRREQEREQLLCEGRREKAADPAMEL RLKQPSEVELEEYYPAFLDMVRSLLEGSIDPTQYEDTLREMFTIHAYIGFTMDKLVQNIA RQLHHLVSDDVCLKVVELYLNEQQRGAAGGNLSSRCVRAARETSYQWKAERCMADENCFK VMFLQRRGQVIMTIELLDTEEAQTEDPVEVQHLARYVEQYVGSEGASSSSTEGFLLKPVF LQRNLKKFRRWQCEQVRAMRGEAKSSWKRLMGVESACDVDCRFRLGTHKMVFIVNSEDYM
Sin3a_C |
![]() |
---|
PFAM accession number: | PF16879 |
---|---|
Interpro abstract (IPR031693): | This entry represents a domain found in the C-terminal of the transcriptional repressor Sin3. Budding yeast Sin3 is a component of both the Rpd3S and Rpd3L histone deacetylase complexes [ (PUBMED:16314178) ]. In mammals there are two Sin3 paraologues, Sin3A and Sin3B. They forms the larger Sin3L/Rpd3L and the smaller Sin3S/Rpd3S complexes, both complexes rely largely on HDAC (histone deacetylase) activity to affect transcriptional repression. Sin3A and Sin3B may partition into the Sin3L/Rpd3L and Sin3S/Rpd3S complexes, respectively [ (PUBMED:26124119) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Sin3a_C