The domain within your query sequence starts at position 1484 and ends at position 1541; the E-value for the Slx4 domain shown below is 3e-17.
EEAVRRYIRSKPALHRQVLRYQPVELAELQAELKQNGIPVAMGKLSDILDAQCITFTT
Slx4 |
---|
PFAM accession number: | PF09494 |
---|---|
Interpro abstract (IPR018574): | The Slx4 protein is a heteromeric structure-specific endonuclease found from fungi to mammals. Slx4 is a regulatory subunit of the SLX1-SLX4 structure-specific endonuclease that resolves DNA secondary structures generated during DNA repair and recombination [ (PUBMED:19595721) (PUBMED:19596236) ]. The SLX1-SLX4 complex has a preference for 5'-flap structures, and promotes symmetrical cleavage of static and migrating Holliday junctions (HJs) [ (PUBMED:12832395) (PUBMED:18471978) ]. Defects in SLX4 are the cause of Fanconi anemia complementation group P (FANCP), which is a disorder affecting all bone marrow elements and resulting in anemia, leukopenia and thrombopenia [ (PUBMED:21240277) (PUBMED:21240275) ]. |
GO process: | DNA repair (GO:0006281), DNA replication (GO:0006260) |
GO component: | Slx1-Slx4 complex (GO:0033557), nucleus (GO:0005634) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Slx4