The domain within your query sequence starts at position 563 and ends at position 617; the E-value for the Smoothelin domain shown below is 2.7e-23.

QARVDKGPEGRSPLSAEELTAIEDEGVLDKMLDQTTNFEERKLIRAALRELRQRK

Smoothelin

Smoothelin
PFAM accession number:PF12510
Interpro abstract (IPR022189):

This entry represents a domain found in the smoothelin protein, which is a smooth muscle-specific cytoskeletal protein exclusively found in differentiated smooth muscle cells [ (PUBMED:19950405) ]. This domain is found in association with the calponin homology domain ( IPR001715 ).

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Smoothelin