The domain within your query sequence starts at position 563 and ends at position 617; the E-value for the Smoothelin domain shown below is 2.8e-23.
QARVDKGPEGRSPLSAEELTAIEDEGVLDKMLDQTTNFEERKLIRAALRELRQRK
Smoothelin |
![]() |
---|
PFAM accession number: | PF12510 |
---|---|
Interpro abstract (IPR022189): | This entry represents a domain found in the smoothelin protein, which is a smooth muscle-specific cytoskeletal protein exclusively found in differentiated smooth muscle cells [ (PUBMED:19950405) ]. This domain is found in association with the calponin homology domain ( IPR001715 ). |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Smoothelin