The domain within your query sequence starts at position 12 and ends at position 197; the E-value for the Snf7 domain shown below is 5.4e-58.
APPPSLTDCIGTVDSRAESIDKKISRLDAELVKYKDQIKKMREGPAKNMVKQKALRVLKQ KRMYEQQRDNLAQQSFNMEQANYTIQSLKDTKTTVDAMKLGVKEMKKAYKEVKIDQIEDL QDQLEDMMEDANEIQEALGRSYGTPELDEDDLEAELDALGDELLADEDSSYLDEAASAPA IPEGVP
Snf7 |
![]() |
---|
PFAM accession number: | PF03357 |
---|---|
Interpro abstract (IPR005024): | Snf7 family members are small coil-coiled proteins that share protein sequence similarity with budding yeast Snf7, which is part of the ESCRT-III complex that is required for endosome-mediated trafficking via multivesicular body (MVB) formation and sorting [ (PUBMED:15086794) ]. Proteins in this entry also includes human CHMPs (charged multivesicular body proteins), budding yeast Did4/Did2, Arabidopsis vacuolar protein sorting-associated proteins and the archaean Sulfolobus acidocaldarius cell division protein B which is a component required for cell division, forming polymers with segregating nucleoids [ (PUBMED:18987308) ]. |
GO process: | vacuolar transport (GO:0007034) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Snf7