SMART: Pfam domain Snf7

The domain within your query sequence starts at position 18 and ends at position 188; the E-value for the Snf7 domain shown below is 7.6e-42.

EWSLKIRKEMRVVDRQIRDIQREEEKVKRSVKDAAKKGQKEVCVVLAKEMIRSRKAVSKL
YASKAHMNSVLMGMKNQLAVLRVAGSLQKSTEVMKAMQSLVKIPEIQATMRELSKEMMKA
GIIEEMLEDTFESMDDQEEMEEAAEMEIDRILFEITAGALGKAPSKVTDAL

Snf7

PFAM accession number:	PF03357
Interpro abstract (IPR005024):	Snf7 family members are small coil-coiled proteins that share protein sequence similarity with budding yeast Snf7, which is part of the ESCRT-III complex that is required for endosome-mediated trafficking via multivesicular body (MVB) formation and sorting [ (PUBMED:15086794) ]. Proteins in this entry also includes human CHMPs (charged multivesicular body proteins), budding yeast Did4/Did2, Arabidopsis vacuolar protein sorting-associated proteins and the archaean Sulfolobus acidocaldarius cell division protein B which is a component required for cell division, forming polymers with segregating nucleoids [ (PUBMED:18987308) ].
GO process:	vacuolar transport (GO:0007034)

PFAM accession number:

PF03357

Interpro abstract (IPR005024):

Snf7 family members are small coil-coiled proteins that share protein sequence similarity with budding yeast Snf7, which is part of the ESCRT-III complex that is required for endosome-mediated trafficking via multivesicular body (MVB) formation and sorting [ (PUBMED:15086794) ].

Proteins in this entry also includes human CHMPs (charged multivesicular body proteins), budding yeast Did4/Did2, Arabidopsis vacuolar protein sorting-associated proteins and the archaean Sulfolobus acidocaldarius cell division protein B which is a component required for cell division, forming polymers with segregating nucleoids [ (PUBMED:18987308) ].

GO process:

vacuolar transport (GO:0007034)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Snf7