The domain within your query sequence starts at position 75 and ends at position 192; the E-value for the Spc24 domain shown below is 1.1e-19.
QGDTELQQLEVELQRTSKEDTCVQARLRQLITELQELREMEEELQRQERDVDEDNTVTIP SAVYVAHLYHQISKIQWDYECEPGMIKGIHHGPTVAQPIHLDSAQLSPKFISDYLWSL
Spc24 |
![]() |
---|
PFAM accession number: | PF08286 |
---|---|
Interpro abstract (IPR013252): | Spc24 is a component of the evolutionarily conserved kinetochore-associated Ndc80 complex, which is implicated in several essential outer kinetochore functions, including microtubule binding and control the spindle assembly checkpoint [ (PUBMED:17521635) (PUBMED:11266451) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Spc24