The domain within your query sequence starts at position 274 and ends at position 384; the E-value for the Spectrin domain shown below is 5.9e-17.
QLMEDYEKLASDLLEWIRRTIPWLENRVPENTMHAMQQKLEDFRDYRRLHKPPKVQEKCQ LEINFNTLQTKLRLSNRPAFMPSEGRMVSDINNAWGCLEQAEKGYEEWLLN
Spectrin |
![]() |
---|
PFAM accession number: | PF00435 |
---|---|
Interpro abstract (IPR002017): | Spectrin repeats [ (PUBMED:8266097) ] are found in several proteins involved in cytoskeletal structure. These include spectrin alpha and beta subunits [ (PUBMED:12672815) (PUBMED:15062087) ], alpha-actinin [ (PUBMED:10481917) ] and dystrophin. The spectrin repeat forms a three-helix bundle. The second helix is interrupted by proline in some sequences. The repeats are defined by a characteristic tryptophan (W) residue at position 17 in helix A and a leucine (L) at 2 residues from the carboxyl end of helix C. |
GO function: | protein binding (GO:0005515) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Spectrin